Plant-Made Trastuzumab (Herceptin) Inhibits HER2/Neu+ Cell Proliferation and Retards Tumor Growth
Loading … Spinner

Mendeley | Further Information

{"title"=>"Plant-made trastuzumab (Herceptin) inhibits HER2/Neu+ cell proliferation and retards tumor growth", "type"=>"journal", "authors"=>[{"first_name"=>"Tatiana V.", "last_name"=>"Komarova", "scopus_author_id"=>"7005623058"}, {"first_name"=>"Vyacheslav S.", "last_name"=>"Kosorukov", "scopus_author_id"=>"6505962801"}, {"first_name"=>"Olga Y.", "last_name"=>"Frolova", "scopus_author_id"=>"7006584649"}, {"first_name"=>"Igor V.", "last_name"=>"Petrunia", "scopus_author_id"=>"24491077100"}, {"first_name"=>"Ksenia A.", "last_name"=>"Skrypnik", "scopus_author_id"=>"37010028500"}, {"first_name"=>"Yuri Y.", "last_name"=>"Gleba", "scopus_author_id"=>"7003670117"}, {"first_name"=>"Yuri L.", "last_name"=>"Dorokhov", "scopus_author_id"=>"6603938889"}], "year"=>2011, "source"=>"PLoS ONE", "identifiers"=>{"scopus"=>"2-s2.0-79952299823", "sgr"=>"79952299823", "issn"=>"19326203", "doi"=>"10.1371/journal.pone.0017541", "pmid"=>"21390232", "isbn"=>"1932-6203", "pui"=>"361382340"}, "id"=>"f0146bed-856c-34d9-9d74-c50f922b6aa9", "abstract"=>"BACKGROUND: Plant biotechnology provides a valuable contribution to global health, in part because it can decrease the cost of pharmaceutical products. Breast cancer can now be successfully treated by a humanized monoclonal antibody (mAb), trastuzumab (Herceptin). A course of treatment, however, is expensive and requires repeated administrations of the mAb. Here we used an Agrobacterium-mediated transient expression system to produce trastuzumab in plant cells.\\n\\nMETHODOLOGY/PRINCIPAL FINDINGS: We describe the cloning and expression of gene constructs in Nicotiana benthamiana plants using intron-optimized Tobacco mosaic virus- and Potato virus X-based vectors encoding, respectively, the heavy and light chains of trastuzumab. Full-size antibodies extracted and purified from plant tissues were tested for functionality and specificity by (i) binding to HER2/neu on the surface of a human mammary gland adenocarcinoma cell line, SK-BR-3, in fluorescence-activated cell sorting assay and (ii) testing the in vitro and in vivo inhibition of HER-2-expressing cancer cell proliferation. We show that plant-made trastuzumab (PMT) bound to the Her2/neu oncoprotein of SK-BR-3 cells and efficiently inhibited SK-BR-3 cell proliferation. Furthermore, mouse intraperitoneal PMT administration retarded the growth of xenografted tumors derived from human ovarian cancer SKOV3 Her2+ cells.\\n\\nCONCLUSIONS/SIGNIFICANCE: We conclude that PMT is active in suppression of cell proliferation and tumor growth.", "link"=>"", "reader_count"=>58, "reader_count_by_academic_status"=>{"Professor > Associate Professor"=>3, "Librarian"=>2, "Student > Doctoral Student"=>1, "Researcher"=>20, "Student > Ph. D. Student"=>11, "Student > Postgraduate"=>4, "Student > Master"=>5, "Other"=>2, "Student > Bachelor"=>9, "Professor"=>1}, "reader_count_by_user_role"=>{"Professor > Associate Professor"=>3, "Librarian"=>2, "Student > Doctoral Student"=>1, "Researcher"=>20, "Student > Ph. D. Student"=>11, "Student > Postgraduate"=>4, "Student > Master"=>5, "Other"=>2, "Student > Bachelor"=>9, "Professor"=>1}, "reader_count_by_subject_area"=>{"Engineering"=>2, "Unspecified"=>1, "Biochemistry, Genetics and Molecular Biology"=>8, "Materials Science"=>1, "Agricultural and Biological Sciences"=>35, "Medicine and Dentistry"=>4, "Design"=>1, "Pharmacology, Toxicology and Pharmaceutical Science"=>1, "Chemistry"=>3, "Social Sciences"=>1, "Economics, Econometrics and Finance"=>1}, "reader_count_by_subdiscipline"=>{"Design"=>{"Design"=>1}, "Engineering"=>{"Engineering"=>2}, "Materials Science"=>{"Materials Science"=>1}, "Medicine and Dentistry"=>{"Medicine and Dentistry"=>4}, "Chemistry"=>{"Chemistry"=>3}, "Social Sciences"=>{"Social Sciences"=>1}, "Economics, Econometrics and Finance"=>{"Economics, Econometrics and Finance"=>1}, "Agricultural and Biological Sciences"=>{"Agricultural and Biological Sciences"=>35}, "Biochemistry, Genetics and Molecular Biology"=>{"Biochemistry, Genetics and Molecular Biology"=>8}, "Unspecified"=>{"Unspecified"=>1}, "Pharmacology, Toxicology and Pharmaceutical Science"=>{"Pharmacology, Toxicology and Pharmaceutical Science"=>1}}, "reader_count_by_country"=>{"Canada"=>1}, "group_count"=>5}

Scopus | Further Information

{"@_fa"=>"true", "link"=>[{"@_fa"=>"true", "@ref"=>"self", "@href"=>""}, {"@_fa"=>"true", "@ref"=>"author-affiliation", "@href"=>",affiliation"}, {"@_fa"=>"true", "@ref"=>"scopus", "@href"=>""}, {"@_fa"=>"true", "@ref"=>"scopus-citedby", "@href"=>""}], "prism:url"=>"", "dc:identifier"=>"SCOPUS_ID:79952299823", "eid"=>"2-s2.0-79952299823", "dc:title"=>"Plant-made trastuzumab (Herceptin) inhibits HER2/Neu+ cell proliferation and retards tumor growth", "dc:creator"=>"Komarova T.", "prism:publicationName"=>"PLoS ONE", "prism:eIssn"=>"19326203", "prism:volume"=>"6", "prism:issueIdentifier"=>"3", "prism:pageRange"=>nil, "prism:coverDate"=>"2011-03-10", "prism:coverDisplayDate"=>"2011", "prism:doi"=>"10.1371/journal.pone.0017541", "citedby-count"=>"29", "affiliation"=>[{"@_fa"=>"true", "affilname"=>"Lomonosov Moscow State University", "affiliation-city"=>"Moscow", "affiliation-country"=>"Russian Federation"}], "pubmed-id"=>"21390232", "prism:aggregationType"=>"Journal", "subtype"=>"ar", "subtypeDescription"=>"Article", "article-number"=>"e17541", "source-id"=>"10600153309", "openaccess"=>"1", "openaccessFlag"=>true}


  • {"url"=>"", "share_count"=>0, "like_count"=>0, "comment_count"=>0, "click_count"=>0, "total_count"=>0}


  • {"month"=>"3", "year"=>"2011", "pdf_views"=>"123", "xml_views"=>"9", "html_views"=>"517"}
  • {"month"=>"4", "year"=>"2011", "pdf_views"=>"51", "xml_views"=>"1", "html_views"=>"167"}
  • {"month"=>"5", "year"=>"2011", "pdf_views"=>"28", "xml_views"=>"0", "html_views"=>"73"}
  • {"month"=>"6", "year"=>"2011", "pdf_views"=>"25", "xml_views"=>"1", "html_views"=>"67"}
  • {"month"=>"7", "year"=>"2011", "pdf_views"=>"16", "xml_views"=>"0", "html_views"=>"50"}
  • {"month"=>"8", "year"=>"2011", "pdf_views"=>"17", "xml_views"=>"0", "html_views"=>"73"}
  • {"month"=>"9", "year"=>"2011", "pdf_views"=>"28", "xml_views"=>"0", "html_views"=>"104"}
  • {"month"=>"10", "year"=>"2011", "pdf_views"=>"20", "xml_views"=>"0", "html_views"=>"74"}
  • {"month"=>"11", "year"=>"2011", "pdf_views"=>"32", "xml_views"=>"4", "html_views"=>"102"}
  • {"month"=>"12", "year"=>"2011", "pdf_views"=>"16", "xml_views"=>"0", "html_views"=>"89"}
  • {"month"=>"1", "year"=>"2012", "pdf_views"=>"22", "xml_views"=>"0", "html_views"=>"94"}
  • {"month"=>"2", "year"=>"2012", "pdf_views"=>"24", "xml_views"=>"0", "html_views"=>"125"}
  • {"month"=>"3", "year"=>"2012", "pdf_views"=>"23", "xml_views"=>"1", "html_views"=>"106"}
  • {"month"=>"4", "year"=>"2012", "pdf_views"=>"14", "xml_views"=>"1", "html_views"=>"82"}
  • {"month"=>"5", "year"=>"2012", "pdf_views"=>"24", "xml_views"=>"0", "html_views"=>"106"}
  • {"month"=>"6", "year"=>"2012", "pdf_views"=>"14", "xml_views"=>"0", "html_views"=>"62"}
  • {"month"=>"7", "year"=>"2012", "pdf_views"=>"17", "xml_views"=>"0", "html_views"=>"70"}
  • {"month"=>"8", "year"=>"2012", "pdf_views"=>"18", "xml_views"=>"5", "html_views"=>"67"}
  • {"month"=>"9", "year"=>"2012", "pdf_views"=>"20", "xml_views"=>"0", "html_views"=>"118"}
  • {"month"=>"10", "year"=>"2012", "pdf_views"=>"25", "xml_views"=>"0", "html_views"=>"111"}
  • {"month"=>"11", "year"=>"2012", "pdf_views"=>"21", "xml_views"=>"0", "html_views"=>"104"}
  • {"month"=>"12", "year"=>"2012", "pdf_views"=>"16", "xml_views"=>"0", "html_views"=>"66"}
  • {"month"=>"1", "year"=>"2013", "pdf_views"=>"16", "xml_views"=>"0", "html_views"=>"127"}
  • {"month"=>"2", "year"=>"2013", "pdf_views"=>"15", "xml_views"=>"1", "html_views"=>"98"}
  • {"month"=>"3", "year"=>"2013", "pdf_views"=>"14", "xml_views"=>"0", "html_views"=>"116"}
  • {"month"=>"4", "year"=>"2013", "pdf_views"=>"9", "xml_views"=>"0", "html_views"=>"125"}
  • {"month"=>"5", "year"=>"2013", "pdf_views"=>"18", "xml_views"=>"0", "html_views"=>"185"}
  • {"month"=>"6", "year"=>"2013", "pdf_views"=>"17", "xml_views"=>"1", "html_views"=>"110"}
  • {"month"=>"7", "year"=>"2013", "pdf_views"=>"21", "xml_views"=>"0", "html_views"=>"152"}
  • {"month"=>"8", "year"=>"2013", "pdf_views"=>"13", "xml_views"=>"0", "html_views"=>"93"}
  • {"month"=>"9", "year"=>"2013", "pdf_views"=>"15", "xml_views"=>"0", "html_views"=>"99"}
  • {"month"=>"10", "year"=>"2013", "pdf_views"=>"17", "xml_views"=>"1", "html_views"=>"135"}
  • {"month"=>"11", "year"=>"2013", "pdf_views"=>"8", "xml_views"=>"2", "html_views"=>"168"}
  • {"month"=>"12", "year"=>"2013", "pdf_views"=>"6", "xml_views"=>"0", "html_views"=>"104"}
  • {"month"=>"1", "year"=>"2014", "pdf_views"=>"11", "xml_views"=>"1", "html_views"=>"100"}
  • {"month"=>"2", "year"=>"2014", "pdf_views"=>"9", "xml_views"=>"0", "html_views"=>"103"}
  • {"month"=>"3", "year"=>"2014", "pdf_views"=>"8", "xml_views"=>"2", "html_views"=>"118"}
  • {"month"=>"4", "year"=>"2014", "pdf_views"=>"7", "xml_views"=>"1", "html_views"=>"134"}
  • {"month"=>"5", "year"=>"2014", "pdf_views"=>"7", "xml_views"=>"0", "html_views"=>"117"}
  • {"month"=>"6", "year"=>"2014", "pdf_views"=>"12", "xml_views"=>"0", "html_views"=>"83"}
  • {"month"=>"7", "year"=>"2014", "pdf_views"=>"7", "xml_views"=>"0", "html_views"=>"70"}
  • {"month"=>"8", "year"=>"2014", "pdf_views"=>"17", "xml_views"=>"2", "html_views"=>"87"}
  • {"month"=>"9", "year"=>"2014", "pdf_views"=>"13", "xml_views"=>"1", "html_views"=>"104"}
  • {"month"=>"10", "year"=>"2014", "pdf_views"=>"18", "xml_views"=>"1", "html_views"=>"113"}
  • {"month"=>"11", "year"=>"2014", "pdf_views"=>"12", "xml_views"=>"1", "html_views"=>"83"}
  • {"month"=>"12", "year"=>"2014", "pdf_views"=>"14", "xml_views"=>"2", "html_views"=>"68"}
  • {"month"=>"1", "year"=>"2015", "pdf_views"=>"7", "xml_views"=>"0", "html_views"=>"31"}
  • {"month"=>"2", "year"=>"2015", "pdf_views"=>"3", "xml_views"=>"0", "html_views"=>"38"}
  • {"month"=>"3", "year"=>"2015", "pdf_views"=>"12", "xml_views"=>"0", "html_views"=>"109"}
  • {"month"=>"4", "year"=>"2015", "pdf_views"=>"6", "xml_views"=>"1", "html_views"=>"52"}
  • {"month"=>"5", "year"=>"2015", "pdf_views"=>"8", "xml_views"=>"0", "html_views"=>"63"}
  • {"month"=>"6", "year"=>"2015", "pdf_views"=>"5", "xml_views"=>"0", "html_views"=>"40"}
  • {"month"=>"7", "year"=>"2015", "pdf_views"=>"4", "xml_views"=>"0", "html_views"=>"37"}
  • {"month"=>"8", "year"=>"2015", "pdf_views"=>"7", "xml_views"=>"1", "html_views"=>"38"}
  • {"month"=>"9", "year"=>"2015", "pdf_views"=>"12", "xml_views"=>"0", "html_views"=>"74"}
  • {"month"=>"10", "year"=>"2015", "pdf_views"=>"9", "xml_views"=>"0", "html_views"=>"66"}
  • {"month"=>"11", "year"=>"2015", "pdf_views"=>"8", "xml_views"=>"0", "html_views"=>"65"}
  • {"month"=>"12", "year"=>"2015", "pdf_views"=>"10", "xml_views"=>"0", "html_views"=>"84"}
  • {"month"=>"1", "year"=>"2016", "pdf_views"=>"11", "xml_views"=>"0", "html_views"=>"55"}
  • {"month"=>"2", "year"=>"2016", "pdf_views"=>"1", "xml_views"=>"0", "html_views"=>"53"}
  • {"month"=>"3", "year"=>"2016", "pdf_views"=>"8", "xml_views"=>"0", "html_views"=>"88"}
  • {"month"=>"4", "year"=>"2016", "pdf_views"=>"13", "xml_views"=>"0", "html_views"=>"59"}
  • {"month"=>"5", "year"=>"2016", "pdf_views"=>"9", "xml_views"=>"0", "html_views"=>"53"}
  • {"month"=>"6", "year"=>"2016", "pdf_views"=>"4", "xml_views"=>"0", "html_views"=>"33"}
  • {"month"=>"7", "year"=>"2016", "pdf_views"=>"4", "xml_views"=>"0", "html_views"=>"25"}
  • {"month"=>"8", "year"=>"2016", "pdf_views"=>"11", "xml_views"=>"0", "html_views"=>"48"}
  • {"month"=>"9", "year"=>"2016", "pdf_views"=>"6", "xml_views"=>"0", "html_views"=>"110"}
  • {"month"=>"10", "year"=>"2016", "pdf_views"=>"10", "xml_views"=>"0", "html_views"=>"217"}
  • {"month"=>"11", "year"=>"2016", "pdf_views"=>"4", "xml_views"=>"0", "html_views"=>"297"}
  • {"month"=>"12", "year"=>"2016", "pdf_views"=>"8", "xml_views"=>"0", "html_views"=>"192"}
  • {"month"=>"1", "year"=>"2017", "pdf_views"=>"11", "xml_views"=>"5", "html_views"=>"200"}
  • {"month"=>"2", "year"=>"2017", "pdf_views"=>"4", "xml_views"=>"1", "html_views"=>"130"}
  • {"month"=>"3", "year"=>"2017", "pdf_views"=>"11", "xml_views"=>"0", "html_views"=>"78"}
  • {"month"=>"4", "year"=>"2017", "pdf_views"=>"10", "xml_views"=>"1", "html_views"=>"64"}
  • {"month"=>"5", "year"=>"2017", "pdf_views"=>"7", "xml_views"=>"0", "html_views"=>"55"}
  • {"month"=>"6", "year"=>"2017", "pdf_views"=>"12", "xml_views"=>"0", "html_views"=>"64"}
  • {"month"=>"7", "year"=>"2017", "pdf_views"=>"9", "xml_views"=>"2", "html_views"=>"56"}
  • {"month"=>"8", "year"=>"2017", "pdf_views"=>"6", "xml_views"=>"1", "html_views"=>"55"}
  • {"month"=>"9", "year"=>"2017", "pdf_views"=>"13", "xml_views"=>"2", "html_views"=>"53"}
  • {"month"=>"10", "year"=>"2017", "pdf_views"=>"7", "xml_views"=>"6", "html_views"=>"116"}
  • {"month"=>"11", "year"=>"2017", "pdf_views"=>"12", "xml_views"=>"6", "html_views"=>"104"}
  • {"month"=>"12", "year"=>"2017", "pdf_views"=>"13", "xml_views"=>"13", "html_views"=>"59"}
  • {"month"=>"1", "year"=>"2018", "pdf_views"=>"5", "xml_views"=>"8", "html_views"=>"73"}
  • {"month"=>"2", "year"=>"2018", "pdf_views"=>"12", "xml_views"=>"8", "html_views"=>"42"}
  • {"month"=>"3", "year"=>"2018", "pdf_views"=>"12", "xml_views"=>"6", "html_views"=>"55"}
  • {"month"=>"4", "year"=>"2018", "pdf_views"=>"26", "xml_views"=>"1", "html_views"=>"49"}
  • {"month"=>"5", "year"=>"2018", "pdf_views"=>"5", "xml_views"=>"0", "html_views"=>"71"}
  • {"month"=>"6", "year"=>"2018", "pdf_views"=>"1", "xml_views"=>"0", "html_views"=>"26"}
  • {"month"=>"7", "year"=>"2018", "pdf_views"=>"8", "xml_views"=>"4", "html_views"=>"43"}
  • {"month"=>"8", "year"=>"2018", "pdf_views"=>"13", "xml_views"=>"1", "html_views"=>"49"}
  • {"month"=>"9", "year"=>"2018", "pdf_views"=>"15", "xml_views"=>"0", "html_views"=>"41"}
  • {"month"=>"10", "year"=>"2018", "pdf_views"=>"5", "xml_views"=>"1", "html_views"=>"71"}
  • {"month"=>"11", "year"=>"2018", "pdf_views"=>"8", "xml_views"=>"0", "html_views"=>"52"}
  • {"month"=>"12", "year"=>"2018", "pdf_views"=>"19", "xml_views"=>"0", "html_views"=>"36"}
  • {"month"=>"1", "year"=>"2019", "pdf_views"=>"8", "xml_views"=>"0", "html_views"=>"42"}
  • {"month"=>"2", "year"=>"2019", "pdf_views"=>"13", "xml_views"=>"1", "html_views"=>"42"}
  • {"month"=>"3", "year"=>"2019", "pdf_views"=>"20", "xml_views"=>"0", "html_views"=>"48"}
  • {"month"=>"4", "year"=>"2019", "pdf_views"=>"18", "xml_views"=>"2", "html_views"=>"44"}
  • {"month"=>"5", "year"=>"2019", "pdf_views"=>"26", "xml_views"=>"0", "html_views"=>"48"}
  • {"month"=>"6", "year"=>"2019", "pdf_views"=>"18", "xml_views"=>"0", "html_views"=>"27"}
  • {"month"=>"7", "year"=>"2019", "pdf_views"=>"9", "xml_views"=>"0", "html_views"=>"29"}
  • {"month"=>"8", "year"=>"2019", "pdf_views"=>"21", "xml_views"=>"0", "html_views"=>"17"}


  • {"files"=>[""], "description"=>"<p><b>A</b> – Schematic representation of 35S-based light- (LC) and heavy-(HC) chain- expressing vectors 35S-LC and 35S-HC, respectively. 35S – Cauliflower mosaic virus 35S promoter, T – terminator of transcription, RB and LB – right and left borders from Ti-plasmid. <b>B</b> – Coomassie blue-stained SDS-PAGE proteins before purification (lane 1) and eluted fractions (3–11) obtained after protein A affinity chromatography, lane 2 – flow through after the first loading on the protein A column. M, molecular weight markers. <b>C</b>, <b>D</b> - Western blot analysis of PMT under reducing conditions, developed with anti-gamma (<b>C</b>) and -kappa (<b>D</b>)-chain-specific antibodies.</p>", "links"=>[], "tags"=>["assembled", "pmt", "leaves", "co-injected", "35s-based", "light-", "heavy-chain-expressing"], "article_id"=>463934, "categories"=>["Cancer", "Biotechnology", "Plant Biology"], "users"=>["Tatiana V. Komarova", "Vyacheslav S. Kosorukov", "Olga Y. Frolova", "Igor V. Petrunia", "Ksenia A. Skrypnik", "Yuri Y. Gleba", "Yuri L. Dorokhov"], "doi"=>"", "stats"=>{"downloads"=>1, "page_views"=>10, "likes"=>0}, "figshare_url"=>"", "title"=>"Production of assembled PMT in <i>N. benthamiana</i> leaves co-injected with 35S-based light- and heavy-chain-expressing vectors.", "pos_in_sequence"=>0, "defined_type"=>1, "published_date"=>"2011-03-03 01:05:34"}
  • {"files"=>[""], "description"=>"<p>Flow cytometry analysis of SK-BR-3 cells expressing HER2/neu incubated with trastuzumab (A–C) and PMT (D–F) in the following concentrations: 10 µg/ml (A,D), 1 µg/ml (B,E), and 0.1 µg/ml (C,F). Cells incubated only with secondary reagents were included as a control (open peak). Shadowed areas show specific binding. The percentage of cell surface expression of HER2/neu in SK-BR-3 cells is shown. These data represent three separate experiments.</p>", "links"=>[], "tags"=>["pmt", "binding"], "article_id"=>464265, "categories"=>["Cancer", "Biotechnology", "Plant Biology"], "users"=>["Tatiana V. Komarova", "Vyacheslav S. Kosorukov", "Olga Y. Frolova", "Igor V. Petrunia", "Ksenia A. Skrypnik", "Yuri Y. Gleba", "Yuri L. Dorokhov"], "doi"=>"", "stats"=>{"downloads"=>2, "page_views"=>9, "likes"=>0}, "figshare_url"=>"", "title"=>"Examination of PMT binding to HER2/neu.", "pos_in_sequence"=>0, "defined_type"=>1, "published_date"=>"2011-03-03 01:11:05"}
  • {"files"=>[""], "description"=>"<p>Growth inhibition effect of PMT compared to trastuzumab (Herceptin, Hoffmann-La Roche) and rituximab (Hoffmann-La Roche) as a negative control. This assay was repeated at least three times.</p>", "links"=>[], "tags"=>["pmt", "cancer", "sk-br-3", "mtt"], "article_id"=>464341, "categories"=>["Cancer", "Biotechnology", "Plant Biology"], "users"=>["Tatiana V. Komarova", "Vyacheslav S. Kosorukov", "Olga Y. Frolova", "Igor V. Petrunia", "Ksenia A. Skrypnik", "Yuri Y. Gleba", "Yuri L. Dorokhov"], "doi"=>"", "stats"=>{"downloads"=>1, "page_views"=>13, "likes"=>0}, "figshare_url"=>"", "title"=>"Effects of PMT on growth of the breast cancer cell line SK-BR-3 in MTT assays.", "pos_in_sequence"=>0, "defined_type"=>1, "published_date"=>"2011-03-03 01:12:21"}
  • {"files"=>[""], "description"=>"<p>The treatment groups received their first doses (20 mg/kg) of PMT (n = 7) and trastuzumab (n = 10) in saline solution i.p. 6 days after SKOV3 implantation, and then for 16 days, they received 8 consecutive injections (10 mg/kg). The control group (n = 34) received saline solution. Tumor volumes were recorded in intervals 10–14, 18–22 and 23–27 days after SKOV3 implantation using a caliper. Data are the mean ± standard deviations from two independent experiments. Asterisk shows P<0.05 by the unpaired two tailed Student's t-test for statistical significance of difference between the PMT and trastuzumab treatment and control.</p>", "links"=>[], "tags"=>["inhibits", "xenograft", "ovarian"], "article_id"=>464399, "categories"=>["Cancer", "Biotechnology", "Plant Biology"], "users"=>["Tatiana V. Komarova", "Vyacheslav S. Kosorukov", "Olga Y. Frolova", "Igor V. Petrunia", "Ksenia A. Skrypnik", "Yuri Y. Gleba", "Yuri L. Dorokhov"], "doi"=>"", "stats"=>{"downloads"=>2, "page_views"=>5, "likes"=>0}, "figshare_url"=>"", "title"=>"PMT inhibits tumor growth in a xenograft model of human Her2+ ovarian cancer.", "pos_in_sequence"=>0, "defined_type"=>1, "published_date"=>"2011-03-03 01:13:19"}
  • {"files"=>["", ""], "description"=>"<div><h3>Background</h3><p>Plant biotechnology provides a valuable contribution to global health, in part because it can decrease the cost of pharmaceutical products. Breast cancer can now be successfully treated by a humanized monoclonal antibody (mAb), trastuzumab (Herceptin). A course of treatment, however, is expensive and requires repeated administrations of the mAb. Here we used an <em>Agrobacterium</em>-mediated transient expression system to produce trastuzumab in plant cells.</p> <h3>Methodology/Principal Findings</h3><p>We describe the cloning and expression of gene constructs in <em>Nicotiana benthamiana</em> plants using intron-optimized <em>Tobacco mosaic virus</em>- and <em>Potato virus X</em>-based vectors encoding, respectively, the heavy and light chains of trastuzumab. Full-size antibodies extracted and purified from plant tissues were tested for functionality and specificity by (i) binding to HER2/neu on the surface of a human mammary gland adenocarcinoma cell line, SK-BR-3, in fluorescence-activated cell sorting assay and (ii) testing the <em>in vitro</em> and <em>in vivo</em> inhibition of HER-2-expressing cancer cell proliferation. We show that plant-made trastuzumab (PMT) bound to the Her2/neu oncoprotein of SK-BR-3 cells and efficiently inhibited SK-BR-3 cell proliferation. Furthermore, mouse intraperitoneal PMT administration retarded the growth of xenografted tumors derived from human ovarian cancer SKOV3 Her2+ cells.</p> <h3>Conclusions/Significance</h3><p>We conclude that PMT is active in suppression of cell proliferation and tumor growth.</p> </div>", "links"=>[], "tags"=>["plant-made", "trastuzumab", "inhibits", "proliferation", "retards"], "article_id"=>138446, "categories"=>["Cancer", "Biotechnology", "Cell Biology"], "users"=>["Tatiana V. Komarova", "Vyacheslav S. Kosorukov", "Olga Y. Frolova", "Igor V. Petrunia", "Ksenia A. Skrypnik", "Yuri Y. Gleba", "Yuri L. Dorokhov"], "doi"=>["", ""], "stats"=>{"downloads"=>0, "page_views"=>10, "likes"=>0}, "figshare_url"=>"", "title"=>"Plant-Made Trastuzumab (Herceptin) Inhibits HER2/Neu+ Cell Proliferation and Retards Tumor Growth", "pos_in_sequence"=>0, "defined_type"=>4, "published_date"=>"2011-03-03 02:20:46"}
  • {"files"=>[""], "description"=>"<p>Comparative binding of trastuzumab and PMT to the HER2/neu-specific cyclic synthetic peptide 563CYC (CHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVA) <a href=\"\" target=\"_blank\">[30]</a>. Microtiter wells were coated overnight with 2 µg/ml peptide and then blocked with 1% BSA for 1 h. The mAbs were then added to plates at a concentration of 250 µg/ml and serially diluted 1∶1 with phosphate buffered saline (PBS). Bound mAb was detected with HRP-conjugated anti-human IgG and then with substrate.</p>", "links"=>[], "tags"=>["pmt", "peptide"], "article_id"=>464203, "categories"=>["Cancer", "Biotechnology", "Plant Biology"], "users"=>["Tatiana V. Komarova", "Vyacheslav S. Kosorukov", "Olga Y. Frolova", "Igor V. Petrunia", "Ksenia A. Skrypnik", "Yuri Y. Gleba", "Yuri L. Dorokhov"], "doi"=>"", "stats"=>{"downloads"=>0, "page_views"=>12, "likes"=>0}, "figshare_url"=>"", "title"=>"Binding of PMT to a HER2/neu peptide mimotope.", "pos_in_sequence"=>0, "defined_type"=>1, "published_date"=>"2011-03-03 01:10:03"}
  • {"files"=>[""], "description"=>"<p><b>A</b> – Schematic representation of PVX- and crTMV-based vectors. LB and RB, binary vector left and right borders, respectively; 35S, 35S promoter; Act 2, <i>Arabidopsis</i> actin 2 promoter; T, <i>nos</i> terminator; RdRp, RNA-dependent RNA polymerase; Bars 1–8, introns; MP, TMV movement protein; 25K, 12K, 8K, PVX movement protein genes. <b>B–E</b> - Western blot analysis of purified PMT. Purification of mAbs on protein A sepharose. Proteins were separated in a 10% polyacrylamide gel under non-reducing conditions (<b>B</b>, <b>C</b>) and in a 12% gel under reducing conditions (<b>D</b>, <b>E</b>) and transferred to a PVDF membrane. Western blots: <b>B</b> and <b>D</b> were probed with gamma-chain-specific antibodies; membranes <b>C</b> and <b>E</b> were incubated with kappa-chain-specific antibodies. 1–2, fractions from the protein A sepharose column; M, protein molecular weight markers; S, standard - 20 ng hIgG. <b>F</b> - Capillary electrophoresis analysis of PMT in reducing conditions on Agilent 2100 Bioanalyzer. Peak 12 corresponds to HC; peak 8 corresponds to LC. <b>G</b>, <b>H</b> – Comparison of PMT and trastuzumab. Proteins were separated in a 7.5% polyacrylamide gel under non-reducing conditions (<b>G</b>) and in a 12% gel under reducing conditions (<b>H</b>) and stained with Coomassie blue. <b>I</b> - RP-HPLC trace analysis of PMT and trastuzumab. The linear gradient was 0–60% acetonitrile for 20 min and then 60–100% acetonitrile for 5 min; the flow rate was 80 µL·min<sup>−1</sup>. The buffer blank was 10 mM Na-phosphate (pH 7.0). Absorbance at 214 nm and 280 nm is shown.</p>", "links"=>[], "tags"=>["purification", "assembled", "pmt", "leaves", "co-injected", "light-chain-encoding", "pvx-based", "heavy-chain-encoding", "tmv-based"], "article_id"=>464088, "categories"=>["Cancer", "Biotechnology", "Plant Biology"], "users"=>["Tatiana V. Komarova", "Vyacheslav S. Kosorukov", "Olga Y. Frolova", "Igor V. Petrunia", "Ksenia A. Skrypnik", "Yuri Y. Gleba", "Yuri L. Dorokhov"], "doi"=>"", "stats"=>{"downloads"=>1, "page_views"=>9, "likes"=>0}, "figshare_url"=>"", "title"=>"Accumulation and purification of assembled PMT in <i>N. benthamiana</i> leaves co-injected with light-chain-encoding PVX-based and heavy-chain-encoding TMV-based vectors.", "pos_in_sequence"=>0, "defined_type"=>1, "published_date"=>"2011-03-03 01:08:08"}

PMC Usage Stats | Further Information

  • {"scanned-page-browse"=>"0", "month"=>"3", "cited-by"=>"0", "abstract"=>"6", "full-text"=>"125", "unique-ip"=>"117", "pdf"=>"68", "year"=>"2011", "figure"=>"11", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"month"=>"4", "scanned-page-browse"=>"0", "cited-by"=>"0", "abstract"=>"16", "full-text"=>"106", "year"=>"2011", "pdf"=>"60", "unique-ip"=>"108", "figure"=>"11", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"scanned-page-browse"=>"0", "month"=>"5", "cited-by"=>"0", "abstract"=>"6", "full-text"=>"55", "unique-ip"=>"59", "pdf"=>"32", "year"=>"2011", "figure"=>"15", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"month"=>"6", "scanned-page-browse"=>"0", "cited-by"=>"0", "abstract"=>"1", "full-text"=>"54", "year"=>"2011", "pdf"=>"44", "unique-ip"=>"52", "figure"=>"14", "scanned-summary"=>"0", "supp-data"=>"2"}
  • {"scanned-page-browse"=>"0", "month"=>"7", "cited-by"=>"0", "abstract"=>"2", "full-text"=>"40", "unique-ip"=>"33", "pdf"=>"21", "year"=>"2011", "figure"=>"10", "scanned-summary"=>"0", "supp-data"=>"1"}
  • {"month"=>"8", "scanned-page-browse"=>"0", "cited-by"=>"0", "abstract"=>"2", "full-text"=>"76", "year"=>"2011", "pdf"=>"33", "unique-ip"=>"62", "figure"=>"13", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"scanned-page-browse"=>"0", "month"=>"9", "cited-by"=>"0", "abstract"=>"0", "full-text"=>"89", "unique-ip"=>"66", "pdf"=>"42", "year"=>"2011", "figure"=>"12", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"month"=>"10", "scanned-page-browse"=>"0", "cited-by"=>"0", "abstract"=>"1", "full-text"=>"65", "year"=>"2011", "pdf"=>"32", "unique-ip"=>"57", "figure"=>"7", "scanned-summary"=>"0", "supp-data"=>"3"}
  • {"scanned-page-browse"=>"0", "month"=>"11", "cited-by"=>"0", "abstract"=>"1", "full-text"=>"60", "unique-ip"=>"55", "pdf"=>"33", "year"=>"2011", "figure"=>"8", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"month"=>"12", "scanned-page-browse"=>"0", "cited-by"=>"0", "abstract"=>"0", "full-text"=>"34", "year"=>"2011", "pdf"=>"20", "unique-ip"=>"32", "figure"=>"8", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"scanned-page-browse"=>"0", "month"=>"1", "cited-by"=>"0", "abstract"=>"0", "full-text"=>"51", "unique-ip"=>"48", "pdf"=>"16", "year"=>"2012", "figure"=>"5", "scanned-summary"=>"0", "supp-data"=>"1"}
  • {"month"=>"2", "scanned-page-browse"=>"0", "cited-by"=>"0", "abstract"=>"1", "full-text"=>"44", "year"=>"2012", "pdf"=>"21", "unique-ip"=>"40", "figure"=>"4", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"scanned-page-browse"=>"0", "month"=>"3", "cited-by"=>"0", "abstract"=>"1", "full-text"=>"54", "unique-ip"=>"45", "pdf"=>"15", "year"=>"2012", "figure"=>"2", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"month"=>"4", "scanned-page-browse"=>"0", "cited-by"=>"0", "abstract"=>"0", "full-text"=>"25", "year"=>"2012", "pdf"=>"13", "unique-ip"=>"26", "figure"=>"5", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"scanned-page-browse"=>"0", "month"=>"5", "cited-by"=>"0", "abstract"=>"0", "full-text"=>"19", "unique-ip"=>"18", "pdf"=>"11", "year"=>"2012", "figure"=>"9", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"month"=>"6", "scanned-page-browse"=>"0", "cited-by"=>"0", "abstract"=>"2", "full-text"=>"24", "year"=>"2012", "pdf"=>"10", "unique-ip"=>"25", "figure"=>"11", "scanned-summary"=>"0", "supp-data"=>"0"}
  • {"unique-ip"=>"24", "full-text"=>"22", "pdf"=>"11", "abstract"=>"1", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2012", "month"=>"7"}
  • {"unique-ip"=>"16", "full-text"=>"16", "pdf"=>"6", "abstract"=>"1", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2012", "month"=>"8"}
  • {"unique-ip"=>"22", "full-text"=>"21", "pdf"=>"10", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2012", "month"=>"9"}
  • {"unique-ip"=>"40", "full-text"=>"39", "pdf"=>"15", "abstract"=>"1", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2012", "month"=>"10"}
  • {"unique-ip"=>"13", "full-text"=>"11", "pdf"=>"7", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2012", "month"=>"12"}
  • {"unique-ip"=>"26", "full-text"=>"28", "pdf"=>"19", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"3", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2013", "month"=>"1"}
  • {"unique-ip"=>"27", "full-text"=>"27", "pdf"=>"11", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2013", "month"=>"3"}
  • {"unique-ip"=>"27", "full-text"=>"32", "pdf"=>"10", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2013", "month"=>"2"}
  • {"unique-ip"=>"25", "full-text"=>"31", "pdf"=>"10", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"9", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2013", "month"=>"4"}
  • {"unique-ip"=>"29", "full-text"=>"30", "pdf"=>"8", "abstract"=>"1", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2012", "month"=>"11"}
  • {"unique-ip"=>"29", "full-text"=>"33", "pdf"=>"13", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"3", "cited-by"=>"0", "year"=>"2013", "month"=>"5"}
  • {"unique-ip"=>"23", "full-text"=>"21", "pdf"=>"12", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"6", "supp-data"=>"1", "cited-by"=>"0", "year"=>"2013", "month"=>"6"}
  • {"unique-ip"=>"24", "full-text"=>"28", "pdf"=>"13", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"2", "cited-by"=>"0", "year"=>"2013", "month"=>"7"}
  • {"unique-ip"=>"17", "full-text"=>"18", "pdf"=>"7", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"5", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2013", "month"=>"8"}
  • {"unique-ip"=>"19", "full-text"=>"20", "pdf"=>"6", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"5", "supp-data"=>"2", "cited-by"=>"0", "year"=>"2013", "month"=>"9"}
  • {"unique-ip"=>"18", "full-text"=>"24", "pdf"=>"7", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"10", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2013", "month"=>"10"}
  • {"unique-ip"=>"9", "full-text"=>"7", "pdf"=>"0", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2013", "month"=>"11"}
  • {"unique-ip"=>"11", "full-text"=>"16", "pdf"=>"7", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"1", "year"=>"2013", "month"=>"12"}
  • {"unique-ip"=>"13", "full-text"=>"15", "pdf"=>"8", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2014", "month"=>"1"}
  • {"unique-ip"=>"8", "full-text"=>"9", "pdf"=>"1", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2014", "month"=>"2"}
  • {"unique-ip"=>"11", "full-text"=>"10", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2014", "month"=>"3"}
  • {"unique-ip"=>"6", "full-text"=>"4", "pdf"=>"1", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"3", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2014", "month"=>"5"}
  • {"unique-ip"=>"5", "full-text"=>"4", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2014", "month"=>"6"}
  • {"unique-ip"=>"15", "full-text"=>"16", "pdf"=>"6", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2014", "month"=>"4"}
  • {"unique-ip"=>"12", "full-text"=>"16", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"10", "supp-data"=>"2", "cited-by"=>"1", "year"=>"2015", "month"=>"4"}
  • {"unique-ip"=>"11", "full-text"=>"17", "pdf"=>"4", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"5"}
  • {"unique-ip"=>"13", "full-text"=>"12", "pdf"=>"5", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"6"}
  • {"unique-ip"=>"10", "full-text"=>"9", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"7"}
  • {"unique-ip"=>"14", "full-text"=>"14", "pdf"=>"5", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"3"}
  • {"unique-ip"=>"13", "full-text"=>"14", "pdf"=>"4", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"2"}
  • {"unique-ip"=>"11", "full-text"=>"17", "pdf"=>"5", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"8"}
  • {"unique-ip"=>"24", "full-text"=>"24", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"9"}
  • {"unique-ip"=>"15", "full-text"=>"15", "pdf"=>"2", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"10"}
  • {"unique-ip"=>"11", "full-text"=>"10", "pdf"=>"10", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"1", "cited-by"=>"0", "year"=>"2014", "month"=>"7"}
  • {"unique-ip"=>"15", "full-text"=>"9", "pdf"=>"5", "abstract"=>"2", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"1", "year"=>"2014", "month"=>"8"}
  • {"unique-ip"=>"16", "full-text"=>"12", "pdf"=>"9", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"2", "cited-by"=>"0", "year"=>"2014", "month"=>"9"}
  • {"unique-ip"=>"15", "full-text"=>"14", "pdf"=>"5", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"6", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2014", "month"=>"10"}
  • {"unique-ip"=>"9", "full-text"=>"13", "pdf"=>"2", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"2"}
  • {"unique-ip"=>"20", "full-text"=>"14", "pdf"=>"10", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"4", "cited-by"=>"0", "year"=>"2014", "month"=>"11"}
  • {"unique-ip"=>"15", "full-text"=>"19", "pdf"=>"11", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2014", "month"=>"12"}
  • {"unique-ip"=>"16", "full-text"=>"18", "pdf"=>"7", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"22", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"1"}
  • {"unique-ip"=>"17", "full-text"=>"14", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"1", "year"=>"2015", "month"=>"11"}
  • {"unique-ip"=>"11", "full-text"=>"15", "pdf"=>"1", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2015", "month"=>"12"}
  • {"unique-ip"=>"19", "full-text"=>"25", "pdf"=>"4", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"1"}
  • {"unique-ip"=>"32", "full-text"=>"35", "pdf"=>"5", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"3"}
  • {"unique-ip"=>"14", "full-text"=>"16", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"4"}
  • {"unique-ip"=>"14", "full-text"=>"14", "pdf"=>"2", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"8", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"5"}
  • {"unique-ip"=>"10", "full-text"=>"8", "pdf"=>"2", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"6"}
  • {"unique-ip"=>"16", "full-text"=>"16", "pdf"=>"2", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"7"}
  • {"unique-ip"=>"8", "full-text"=>"20", "pdf"=>"7", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"51", "year"=>"2016", "month"=>"8"}
  • {"unique-ip"=>"22", "full-text"=>"25", "pdf"=>"4", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"9"}
  • {"unique-ip"=>"18", "full-text"=>"17", "pdf"=>"7", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"10"}
  • {"unique-ip"=>"10", "full-text"=>"9", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"6", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"11"}
  • {"unique-ip"=>"16", "full-text"=>"17", "pdf"=>"5", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2016", "month"=>"12"}
  • {"unique-ip"=>"13", "full-text"=>"13", "pdf"=>"2", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"1"}
  • {"unique-ip"=>"10", "full-text"=>"14", "pdf"=>"6", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"2"}
  • {"unique-ip"=>"17", "full-text"=>"17", "pdf"=>"5", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"3"}
  • {"unique-ip"=>"12", "full-text"=>"21", "pdf"=>"1", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"4"}
  • {"unique-ip"=>"21", "full-text"=>"21", "pdf"=>"9", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"5"}
  • {"unique-ip"=>"13", "full-text"=>"15", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"4", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"6"}
  • {"unique-ip"=>"8", "full-text"=>"14", "pdf"=>"5", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"3", "supp-data"=>"3", "cited-by"=>"0", "year"=>"2017", "month"=>"7"}
  • {"unique-ip"=>"20", "full-text"=>"23", "pdf"=>"3", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"8"}
  • {"unique-ip"=>"20", "full-text"=>"26", "pdf"=>"2", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"11", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"9"}
  • {"unique-ip"=>"30", "full-text"=>"31", "pdf"=>"8", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"10"}
  • {"unique-ip"=>"16", "full-text"=>"16", "pdf"=>"2", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"11"}
  • {"unique-ip"=>"14", "full-text"=>"14", "pdf"=>"5", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2017", "month"=>"12"}
  • {"unique-ip"=>"15", "full-text"=>"15", "pdf"=>"2", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"1"}
  • {"unique-ip"=>"33", "full-text"=>"38", "pdf"=>"4", "abstract"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"9", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"3"}
  • {"unique-ip"=>"20", "full-text"=>"26", "pdf"=>"2", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2019", "month"=>"1"}
  • {"unique-ip"=>"25", "full-text"=>"26", "pdf"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"4"}
  • {"unique-ip"=>"14", "full-text"=>"14", "pdf"=>"2", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"6"}
  • {"unique-ip"=>"27", "full-text"=>"28", "pdf"=>"3", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"5"}
  • {"unique-ip"=>"18", "full-text"=>"17", "pdf"=>"0", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"1", "cited-by"=>"0", "year"=>"2018", "month"=>"7"}
  • {"unique-ip"=>"27", "full-text"=>"27", "pdf"=>"5", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"8"}
  • {"unique-ip"=>"27", "full-text"=>"32", "pdf"=>"3", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"10"}
  • {"unique-ip"=>"38", "full-text"=>"48", "pdf"=>"6", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"11"}
  • {"unique-ip"=>"33", "full-text"=>"43", "pdf"=>"4", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"9"}
  • {"unique-ip"=>"33", "full-text"=>"37", "pdf"=>"5", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"0", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2018", "month"=>"12"}
  • {"unique-ip"=>"34", "full-text"=>"35", "pdf"=>"5", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"2", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2019", "month"=>"2"}
  • {"unique-ip"=>"39", "full-text"=>"43", "pdf"=>"6", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"1", "cited-by"=>"0", "year"=>"2019", "month"=>"3"}
  • {"unique-ip"=>"48", "full-text"=>"49", "pdf"=>"5", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"8", "supp-data"=>"0", "cited-by"=>"0", "year"=>"2019", "month"=>"4"}
  • {"unique-ip"=>"40", "full-text"=>"44", "pdf"=>"10", "scanned-summary"=>"0", "scanned-page-browse"=>"0", "figure"=>"1", "supp-data"=>"0", "cited-by"=>"1", "year"=>"2019", "month"=>"5"}

Relative Metric

{"start_date"=>"2011-01-01T00:00:00Z", "end_date"=>"2011-12-31T00:00:00Z", "subject_areas"=>[{"subject_area"=>"/Biology and life sciences", "average_usage"=>[304, 568, 702, 818, 927, 1027, 1118, 1206, 1285, 1357, 1427, 1500, 1564, 1636, 1705, 1773, 1840, 1909, 1974, 2039, 2106, 2170, 2234, 2296, 2358, 2423, 2484, 2546, 2606, 2673, 2734, 2795, 2857, 2921, 2984, 3046, 3100]}, {"subject_area"=>"/Biology and life sciences/Anatomy and physiology", "average_usage"=>[298, 559, 690, 805, 916, 1018, 1115, 1201, 1283, 1356, 1425, 1498, 1565, 1635, 1703, 1767, 1835, 1902, 1962, 2027, 2089, 2150, 2210, 2265]}, {"subject_area"=>"/Biology and life sciences/Immunology", "average_usage"=>[303, 577, 713, 831, 950, 1048, 1144, 1230, 1307, 1381, 1454, 1521, 1590, 1655, 1713, 1778, 1848, 1913, 1972, 2033, 2098, 2154, 2215, 2263, 2322, 2388, 2436, 2500, 2571, 2623, 2689, 2754, 2806, 2864, 2930, 2984, 3038]}, {"subject_area"=>"/Biology and life sciences/Molecular biology", "average_usage"=>[295, 553, 688, 802, 914, 1017, 1108, 1194, 1278, 1351, 1419, 1500, 1570, 1633, 1712, 1774, 1839, 1903, 1970, 2033, 2101, 2162, 2228, 2291, 2352, 2418, 2486, 2547, 2610, 2680, 2737, 2799, 2859, 2919, 2974, 3029, 3082]}, {"subject_area"=>"/Biology and life sciences/Physiology", "average_usage"=>[296, 551, 687, 800, 903, 1001, 1095, 1184, 1259, 1327, 1406, 1473, 1535, 1600, 1669, 1736, 1794, 1857, 1922, 1983, 2046, 2109, 2169, 2223, 2278, 2344, 2402, 2457, 2517, 2574, 2621, 2688, 2756, 2811, 2872, 2936, 2985]}, {"subject_area"=>"/Medicine and health sciences", "average_usage"=>[303, 571, 709, 823, 937, 1038, 1133, 1216, 1298, 1370, 1447, 1518, 1588, 1656, 1725, 1790, 1856, 1926, 1992, 2054, 2118, 2182, 2242, 2301, 2363, 2425, 2484, 2544, 2602, 2662, 2716, 2776, 2841, 2901, 2960, 3016, 3071]}, {"subject_area"=>"/Medicine and health sciences/Anatomy and physiology", "average_usage"=>[296, 554, 686, 802, 910, 1014, 1104, 1195, 1277, 1349, 1419, 1483, 1551, 1620, 1690, 1757, 1820, 1888, 1957, 2017, 2081, 2140, 2202, 2259]}, {"subject_area"=>"/Medicine and health sciences/Immunology", "average_usage"=>[299, 582, 725, 844, 971, 1076, 1167, 1253, 1328, 1403, 1480, 1551, 1620, 1691, 1756, 1821, 1893, 1962, 2032, 2110, 2178, 2236, 2300, 2358, 2419, 2465, 2529, 2587, 2643, 2700, 2756, 2817, 2869, 2932, 2986, 3046, 3101]}, {"subject_area"=>"/Medicine and health sciences/Oncology", "average_usage"=>[301, 605, 771, 919, 1050, 1160, 1277, 1380, 1481, 1574, 1669, 1766, 1848, 1924, 1996, 2075, 2157, 2238, 2309, 2375, 2458, 2527, 2586, 2676, 2747, 2806, 2865, 2932, 2994, 3059, 3134, 3194, 3256, 3310, 3388, 3467, 3523]}, {"subject_area"=>"/Medicine and health sciences/Pathology and laboratory medicine", "average_usage"=>[303, 579, 723, 839, 947, 1049, 1150, 1233, 1314, 1394, 1469, 1544, 1611, 1682, 1753, 1814, 1879, 1949, 2013, 2081, 2166, 2233, 2297, 2350, 2413, 2465, 2528, 2592, 2652, 2722, 2786, 2857, 2916, 2968, 3032, 3083, 3137]}, {"subject_area"=>"/Medicine and health sciences/Physiology", "average_usage"=>[291, 540, 674, 787, 893, 986, 1087, 1172, 1249, 1319, 1394, 1465, 1526, 1588, 1645, 1713, 1774, 1837, 1903, 1959, 2027, 2085, 2152, 2205, 2259, 2318, 2377, 2436, 2486, 2539, 2603, 2664, 2719, 2779, 2835, 2888, 2944]}]}
Loading … Spinner
There are currently no alerts